Order Entry
United States
ContactUsLinkComponent
Anti-PIMT Rabbit Polyclonal Antibody
Anti-PIMT Rabbit Polyclonal Antibody
Catalog # 102184-840
Supplier:  Novus Biologicals
Anti-PIMT Rabbit Polyclonal Antibody
Catalog # 102184-840
Supplier:  Novus Biologicals
Supplier Number:  NBP1-54942
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Name:
    Protein L-isoaspartyl methyltransferase
  • Antigen Symbol:
    PIMT
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • Isotype:
    IgG
  • Reactivity:
    Human
  • Western Blot:
    Yes
  • Size:
    100 μl
  • Environmentally Preferable:
  • Gene ID:
    96764
  • Antigen Synonyms:
    PRIP-interacting protein PIPMT|Hepatocellular carcinoma-associated antigen 137|EC 2.1.1.-|HCA137|PRIP-interacting protein with methyltransferase motif|nuclear receptor coactivator 6 interacting protein|trimethylguanosine synthase homolog|EC 2.1.1|PIPMT|trimethylguanosine synthase 1|PIMTFLJ22995|trimethylguanosine synthase|CLL-associated antigen KW-2|DKFZp762A163|PRIP-interacting protein with methyltransferase domain|Nuclear receptor coactivator 6-interacting protein|trimethylguanosine synthase homolog (S. cerevisiae)|NCOA6IPSEREX-defined|Cap-specific guanine-N2 methyltransferase
  • Storage Buffer:
    PBS and 2% Sucrose
  • Storage Temperature:
    Store at -20C. Avoid freeze-thaw cycles.
  • Immunogen:
    Synthetic peptides corresponding to TGS1(trimethylguanosine synthase homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TGS1. Peptide sequence IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY.
  • Purification:
    Immunogen affinity purified
  • Cat. No.:
    102184-840
  • Supplier no.:
    NBP1-54942

Specifications

About this item

The PIMT Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIMT. This antibody reacts with human. The PIMT Antibody has been validated for the following applications: Western Blot.

Type: Primary
Antigen: PIMT
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human