To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Name:Olfactory Receptor, Family 1, Subfamily J Member 1
- Antigen Symbol:OR1J1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:347168
- Antigen Synonyms:subfamily J|hg32|family 1|member 1|OR9-18|olfactory receptor|olfactory receptor 1J1|Olfactory receptor OR9-18
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to OR1J1 (olfactory receptor, family 1, subfamily J, member 1) The peptide sequence was selected from the C terminal of OR1J1. Peptide sequence TKGICKALSTCGSHLSVVTIYYRTIIGLYFLPPSSNTNDKNIIASVIYTA.
- Purification:Immunogen affinity purified
- Cat. No.:102198-470
- Supplier no.:NBP1-69092
The OR1J1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OR1J1. This antibody reacts with human. The OR1J1 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: OR1J1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human