To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:3-hydroxy-3-methylglutaryl-CoA Synthase 2 (mitochondrial)
- Antigen Symbol:HMGCS2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100μl
- Environmentally Preferable:
- Gene ID:3158
- Antigen Synonyms:3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial)|3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial)|HMG-CoA synthase|mitochondrial|mitochondrial 3-hydroxy-3-methylglutaryl-CoA synthase|EC 2.3.3.10|hydroxymethylglutaryl-CoA synthase|3-hydroxy-3-methylglutaryl coenzyme A synthase
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to HMGCS2(3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial)) The peptide sequence was selected from the C terminal of HMGCS2. Peptide sequence DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWY
- Purification:Protein A purified
- Cat. No.:102184-946
- Supplier no.:NBP1-54995
Specifications
About this item
Rabbit Polyclonal HMGCS2 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human.
Type: Primary
Antigen: HMGCS2
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human