To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:9653
- Antigen Synonyms:heparan sulfate 2-O-sulfotransferase 1|HS2ST|MGC131986|EC 2.8.2.-|EC 2.8.2|2-O-sulfotransferase|FLJ11317|KIAA0448dJ604K5.2|2OST
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the N terminal of human HS2ST1 (NP_036394). Peptide sequence GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR.
- Purification:Immunogen affinity purified
- Cat. No.:102214-234
- Supplier no.:NBP1-79293
Specifications
About this item
Rabbit Polyclonal Heparan sulfate 2-O-sulfotransferase 1 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human, Mouse, Bovine, Chicken, Xenopus, Zebrafish.
Type: Primary
Antigen: Heparan sulfate 2-O-sulfotransferase 1
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human