Anti-GPSM2 Rabbit Polyclonal Antibody
- Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.
- Return Policy
Product Details & Documents
Rabbit Polyclonal GPSM2 Antibody. Tested Applications: Western Blot, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin. Tested Reactivity: Human, Mouse, Rat, Bovine, Canine, Chicken, Xenopus, Zebrafish.
Type: Primary
Antigen: GPSM2
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human
Documents
NBP1-53125.pdf
Datasheet
Specifications
- Size:100 μl
- Clonality:Polyclonal
- Purification:Immunogen affinity purified
- Storage Buffer:PBS and 2% Sucrose
- ImmunoFluorescence:Yes
- Isotype:IgG
- Host:Rabbit
- Cat. No.:102183-706
- Reactivity:Human
- Western Blot:Yes
- Antibody Type:Primary
- Antigen Symbol:GPSM2
- Gene ID:29899
- Immunogen:Synthetic peptides corresponding to GPSM2(G-protein signaling modulator 2 (AGS3-like, C. elegans)) The peptide sequence was selected from the N terminal of GPSM2 (NP_037428). Peptide sequence YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA.
- ImmunoChemistry:Yes
- Conjugation:Unconjugated
- Antigen Synonyms:deafness|LGNPins|autosomal recessive 82|Mosaic protein LGN|G-protein-signaling modulator 2|G-protein signaling modulator 2|C. elegans)|DFNB82|PINS|G-protein signalling modulator 2 (AGS3-like
- Antigen Name:G-protein signaling modulator 2
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.
Catalog #: 21905-026
Supplier: Kimberly-Clark
Catalog #: 32934-080
Supplier: Kimberly-Clark
Catalog #: 89039-664
Supplier: VWR International