To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Name:Dihydrodiol Dehydrogenase
- Antigen Symbol:DHDH
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:27294
- Antigen Synonyms:EC 1.3.1.20|Hum2DD|D-xylose 1-dehydrogenase|dihydrodiol dehydrogenase (dimeric)|trans-1,2-dihydrobenzene-1,2-diol dehydrogenase|3-deoxyglucosone reductase|Dimeric dihydrodiol dehydrogenase|EC 1.1.1.179,2DD|D-xylose-NADP dehydrogenase
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to DHDH(dihydrodiol dehydrogenase (dimeric)) The peptide sequence was selected from the middle region of DHDH. Peptide sequence PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK.
- Purification:Immunogen affinity purified
- Cat. No.:102188-814
- Supplier no.:NBP1-56950
The DHDH Antibody from Novus Biologicals is a rabbit polyclonal antibody to DHDH. This antibody reacts with human. The DHDH Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: DHDH
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human