To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:DEAD (Asp-Glu-Ala-Asp) box Polypeptide 31
- Antigen Symbol:DDX31
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100μl
- Environmentally Preferable:
- Gene ID:64794
- Antigen Synonyms:probable ATP-dependent RNA helicase DDX31|helicain|FLJ14578|EC 3.6.4.13|FLJ13633|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31|FLJ23349|DEAD (Asp-Glu-Ala-Asp) box polypeptide 31|EC 3.6.1|DEAD box protein 31|DEAD/DEXH helicase DDX31|G2 helicase
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to DDX31 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 31) The peptide sequence was selected from the N terminal of DDX31. Peptide sequence QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS.
- Purification:Protein A purified
- Cat. No.:102189-590
- Supplier no.:NBP1-57349
Specifications
About this item
The DDX31 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX31. This antibody reacts with human. The DDX31 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: DDX31
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human