To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Name:Coatomer Protein Complex, subunit Gamma 2
- Antigen Symbol:COPG2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:26958
- Antigen Synonyms:2-COP|Gamma-2-coat protein|subunit gamma 2|coatomer subunit gamma-2|gamma-2-cop|gamma-2-COP|coatomer protein complex|coat protein|FLJ11781|DKFZp761N09121|nonclathrin
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to COPG2(coatomer protein complex, subunit gamma 2) The peptide sequence was selected from the N terminal of COPG2. Peptide sequence MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK.
- Purification:Immunogen affinity purified
- Cat. No.:102190-154
- Supplier no.:NBP1-57636
The COPG2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COPG2. This antibody reacts with human. The COPG2 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: COPG2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human