To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:CKMT2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100μl
- Environmentally Preferable:
- Gene ID:1160
- Antigen Synonyms:Sarcomeric mitochondrial creatine kinase|Basic-type mitochondrial creatine kinase|mib-CK|SMTCK|creatine kinase S-type|mitochondrial|EC 2.7.3.2|S-MtCK|EC 2.7.3|mitochondrial 2 (sarcomeric)|creatine kinase
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to CKMT2(creatine kinase, mitochondrial 2 (sarcomeric)) The peptide sequence was selected from the N terminal of CKMT2 (NP_001816). Peptide sequence GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA.
- Purification:Protein A purified
- Cat. No.:102184-290
- Supplier no.:NBP1-54661
Specifications
About this item
The CKMT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CKMT2. This antibody reacts with human. The CKMT2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Recommended Dilutions: Immunohistochemistry (Parafin): 4-8 ?g/ml
Type: Primary
Antigen: CKMT2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human