To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:CDK5 Regulatory Subunit Associated Protein 1
- Antigen Symbol:CDK5RAP1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:51654
- Antigen Synonyms:HSPC167|CDK5 regulatory subunit associated protein 1|CGI-05|chromosome 20 open reading frame 34|C20orf34|CDK5 activator-binding protein C42|CDK5RAP1.4|CDK5 regulatory subunit-associated protein 1|CDK5RAP1.3|C42
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the C terminal of human Cdk5rap1The immunogen for this antibody is Cdk5rap1. Peptide sequence VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD.
- Purification:Immunogen affinity purified
- Cat. No.:102214-950
- Supplier no.:NBP1-79651
Specifications
About this item
The CDK5RAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDK5RAP1. This antibody reacts with rat. The CDK5RAP1 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: CDK5RAP1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Rat