To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:CUGBP Elav-like Family member 4
- Antigen Symbol:BRUNOL4
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:56853
- Antigen Synonyms:RNA-binding protein BRUNOL4|LYST-interacting protein LIP9|RNA binding protein|RNA-binding protein BRUNOL-4|Elav-like family member 4|Bruno-like protein 4|RNA binding protein (Drosophila)|CUGBP Elav-like family member 4|CUG-BP and ETR-3 like factor 4|CUG-BP- and ETR-3-like factor 4|CUGBP|BRUNOL4Bruno -like 4|Bruno (Drosophila) -like 4|CELF-4|bruno-like 4|BRUNOL-4
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to BRUNOL4(bruno-like 4, RNA binding protein (Drosophila)) The peptide sequence was selected from the middle region of BRUNOL4 (NP_064565). Peptide sequence PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI.
- Purification:Immunogen affinity purified
- Cat. No.:102189-534
- Supplier no.:NBP1-57320
Specifications
About this item
The BRUNOL4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BRUNOL4. This antibody reacts with human. The BRUNOL4 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: BRUNOL4
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human