Order Entry
United States
ContactUsLinkComponent
Anti-BRUNOL4 Rabbit Polyclonal Antibody
Anti-BRUNOL4 Rabbit Polyclonal Antibody
Catalog # 102189-534
Supplier:  Novus Biologicals
Anti-BRUNOL4 Rabbit Polyclonal Antibody
Catalog # 102189-534
Supplier:  Novus Biologicals
Supplier Number:  NBP1-57320
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Name:
    CUGBP Elav-like Family member 4
  • Antigen Symbol:
    BRUNOL4
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • Isotype:
    IgG
  • Reactivity:
    Human
  • Western Blot:
    Yes
  • Size:
    100 μl
  • Environmentally Preferable:
  • Gene ID:
    56853
  • Antigen Synonyms:
    RNA-binding protein BRUNOL4|LYST-interacting protein LIP9|RNA binding protein|RNA-binding protein BRUNOL-4|Elav-like family member 4|Bruno-like protein 4|RNA binding protein (Drosophila)|CUGBP Elav-like family member 4|CUG-BP and ETR-3 like factor 4|CUG-BP- and ETR-3-like factor 4|CUGBP|BRUNOL4Bruno -like 4|Bruno (Drosophila) -like 4|CELF-4|bruno-like 4|BRUNOL-4
  • Storage Buffer:
    PBS & 2% Sucrose.
  • Storage Temperature:
    Store at -20C. Avoid freeze-thaw cycles.
  • Immunogen:
    Synthetic peptides corresponding to BRUNOL4(bruno-like 4, RNA binding protein (Drosophila)) The peptide sequence was selected from the middle region of BRUNOL4 (NP_064565). Peptide sequence PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI.
  • Purification:
    Immunogen affinity purified
  • Cat. No.:
    102189-534
  • Supplier no.:
    NBP1-57320

Specifications

About this item

The BRUNOL4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BRUNOL4. This antibody reacts with human. The BRUNOL4 Antibody has been validated for the following applications: Western Blot.

Type: Primary
Antigen: BRUNOL4
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human