Order Entry
United States
ContactUsLinkComponent
Anti-APOBEC1 Rabbit Polyclonal Antibody
Anti-APOBEC1 Rabbit Polyclonal Antibody
Catalog # 102189-432
Supplier:  Novus Biologicals
Anti-APOBEC1 Rabbit Polyclonal Antibody
Catalog # 102189-432
Supplier:  Novus Biologicals
Supplier Number:  NBP1-57268
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Name:
    Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide 1
  • Antigen Symbol:
    APOBEC1
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • Isotype:
    IgG
  • Reactivity:
    Human
  • Western Blot:
    Yes
  • Size:
    100 μl
  • Environmentally Preferable:
  • Gene ID:
    339
  • Antigen Synonyms:
    Apolipoprotein B mRNA-editing enzyme 1|CDAR1|catalytic polypeptide 1|U-editing enzyme APOBEC-1|EC 3.5.4.-|EC 3.5.4|apolipoprotein B mRNA editing enzyme|HEPRapolipoprotein B mRNA editing enzyme complex-1|APOBEC-1|BEDPC->
  • Storage Buffer:
    PBS & 2% Sucrose.
  • Storage Temperature:
    Store at -20C. Avoid freeze-thaw cycles.
  • Immunogen:
    Synthetic peptides corresponding to APOBEC1(apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1) The peptide sequence was selected from the N terminal of APOBEC1. Peptide sequence TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKI
  • Purification:
    Immunogen affinity purified
  • Cat. No.:
    102189-432
  • Supplier no.:
    NBP1-57268

Specifications

About this item

The APOBEC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to APOBEC1. This antibody reacts with human. The APOBEC1 Antibody has been validated for the following applications: Western Blot.

Type: Primary
Antigen: APOBEC1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human