Order Entry
United States
ContactUsLinkComponent
Anti-AKAP10 Rabbit Polyclonal Antibody
Anti-AKAP10 Rabbit Polyclonal Antibody
Catalog # 102187-942
Supplier:  Novus Biologicals
Anti-AKAP10 Rabbit Polyclonal Antibody
Catalog # 102187-942
Supplier:  Novus Biologicals
Supplier Number:  NBP1-56509
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Name:
    A-kinase anchor protein 10
  • Antigen Symbol:
    AKAP10
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • Isotype:
    IgG
  • Reactivity:
    Human
  • Western Blot:
    Yes
  • Size:
    100 μl
  • Environmentally Preferable:
  • Gene ID:
    11216
  • Antigen Synonyms:
    AKAP-10|dual-specificity A-kinase anchoring protein 2|mitochondrial A kinase PPKA anchor protein 10|MGC9414|protein kinase A anchoring protein 10|D-AKAP2|Dual specificity A kinase-anchoring protein 2|D-AKAP-2|A kinase (PRKA) anchor protein 10|mitochondrial|PRKA10a kinase anchor protein 10|A-kinase anchor protein 10|Protein kinase A-anchoring protein 10
  • Storage Buffer:
    PBS & 2% Sucrose.
  • Storage Temperature:
    Store at -20C. Avoid freeze-thaw cycles.
  • Immunogen:
    Synthetic peptide directed towards the middle region of human AKAP10 (NP_009133). Peptide sequence ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ.
  • Purification:
    Immunogen affinity purified
  • Cat. No.:
    102187-942
  • Supplier no.:
    NBP1-56509

Specifications

About this item

The AKAP10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKAP10. This antibody reacts with human. The AKAP10 Antibody has been validated for the following applications: Western Blot.

Type: Primary
Antigen: AKAP10
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human