To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:ATP Binding Cassette, Subfamily B, Member 9
- Antigen Symbol:ABCB9
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:23457
- Antigen Synonyms:ATP-binding cassette transporter 9|EC 3.6.3.44|EC 3.6.3|TAP-like protein|KIAA1520|EST122234|ATP-binding cassette|hABCB9|sub-family B (MDR/TAP)|ATP-binding cassette sub-family B member 9|TAPL|ABC transporter 9 protein|member 9
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to ABCB9(ATP-binding cassette, sub-family B (MDR/TAP), member 9) The peptide sequence was selected from the N terminal of ABCB9. Peptide sequence RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW.
- Purification:Immunogen affinity purified
- Cat. No.:102199-068
- Supplier no.:NBP1-69513
Specifications
About this item
The ABCB9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCB9. This antibody reacts with human. The ABCB9 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: ABCB9
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human