About this item
Rabbit monoclonal [ARC1673] antibody to DDX6 for WB and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2,000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: DDX6
Clonality: Monoclonal
Clone: ARC1673
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Catalog No:
- 77232-888
- Antigen Symbol:
- DDX6
- Antigen Name:
- ATP dependent RNA helicase DDX6
- Antigen Synonyms:
- DEAD/H (Asp Glu Ala Asp/His) box polypeptide 6 (RNA helicase 54kD)|FLJ36338|DEAD box protein 6|ATP dependent RNA helicase p54|DEAD (Asp Glu Ala Asp) box polypeptide 6|Oncogene RCK|HLR2|Probable ATP-dependent RNA helicase DDX6|DEAD box 6
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC1673
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P26196
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human DDX6 (P26196).
- Sequence:
- YCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATT
- Form:
- Liquid
- Molecular Weight:
- 54 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze / thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at +4 °C
- Tested Applications:
- ICC/IF