About this item
Rabbit polyclonal antibody to Peroxiredoxin 4 for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Peroxiredoxin 4
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Catalog No:
- 77231-648
- Antigen Symbol:
- Peroxiredoxin 4
- Antigen Name:
- Antioxidant enzyme 372
- Antigen Synonyms:
- Peroxiredoxin-4|Peroxiredoxin4|PRDX 4|Antioxidant enzyme AOE372|Peroxiredoxin IV|Peroxiredoxin 4|EC 1.11.1.15|AOE37 2|AOE37-2
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q13162
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 40-100 of human Peroxiredoxin 4 (PRDX4) (NP_006397.1).
- Sequence:
- TEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKE
- Form:
- Liquid
- Molecular Weight:
- 30 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze / thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at +4 °C
- Tested Applications:
- IHC, ICC/IF
Specifications
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: Janitorial Supplies
Supplier: Kimberly-Clark
Supplier: VWR International
Supplier: VWR International
Supplier: Ansell Healthcare
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International