To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Symbol:vH RAS
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Mouse
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:0.05 mg
- Environmentally Preferable:
- Gene ID:3265
- Antigen Synonyms:N-RAS|Transforming protein p21|Ha-Ras|C-H-RAS|c-has/bas p21 protein|c-ras-Ki-2 activated oncogene|CTLO|Ras family small GTP binding protein H-Ras|GTP- and GDP-binding peptide B|v-Ha-ras Harvey rat sarcoma viral oncogene homolog|H-Ras-1|p21ras|HRAS1|transformation gene: oncogene HAMSV|GTPase HRas|p19 H-RasIDX protein|RASH1|C-HA-RAS1|Ha-Ras1 proto-oncoprotein|H-RASIDX|HAMSV|C-BAS/HAS|K-RAS
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:HRAS (NP_005334, 1 a.a. - 189 a.a.) full-length human protein. MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS
- Tested Applications:Proximity Ligation Assay
- Purification:Protein A purified
- Cat. No.:103328-532
- Supplier no.:H00003265-B01P
The vH RAS Antibody from Novus Biologicals is a mouse polyclonal antibody to vH RAS. This antibody reacts with human. The vH RAS Antibody has been validated for the following applications: Western Blot, Proximity Ligation Assay.
Type: Primary
Antigen: vH RAS
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG
Reactivity: Human