To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:UBASH3B/STS1/Tula-2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Environmentally Preferable:
- Gene ID:84959
- Antigen Synonyms:T-cell ubiquitin ligand 2|TULA-2|P70|Suppressor of T-cell receptor signaling 1|Cbl-interacting protein Sts-1|Cbl-interacting protein p70|suppressor of T-cell receptor signaling1|STS1EC 3.1.3.48|KIAA1959SH3 domain-containing 70 kDa protein|STS-1ubiquitin-associated and SH3 domain-containing protein B|ubiquitin associated and SH3 domain containing B|nm23-phosphorylated unknown substrate|MGC15437|Tyrosine-protein phosphatase STS1/TULA2
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against a recombinant protein corresponding to amino acids: CEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASH
- Purification:Immunogen affinity purified
- Cat. No.:103288-550
- Supplier no.:NBP2-34053
Specifications
About this item
The UBASH3B / STS1 / Tula-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBASH3B / STS1 / Tula-2. This antibody reacts with human. The UBASH3B / STS1 / Tula-2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: UBASH3B/STS1/Tula-2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human