To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:rec-8
- Clonality:Polyclonal
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Rabbit
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:C. elegans
- Size:100 μg
- Environmentally Preferable:
- Epitope:IDNNSELNAIYGCVEPYLREKEITMHSTFVEGNGSNEHNKERRNDAVIADFSQLLFPEIPEITLGEKFPIDVDSRKRS AILQEEQEEALQLPKEASEIVQ
- Storage Buffer:20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Concentration:1 mg/ml
- Immunogen:In vivo generated recominant protein fragment
- Purification:Immunogen affinity purified
- Cat. No.:103317-928
- Supplier no.:49230002-0.1MG
Specifications
About this item
The rec-8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to rec-8. This antibody reacts with c. elegans. The rec-8 Antibody has been validated for the following applications: ELISA, Immunocytochemistry / Immunofluorescence.
Type: Primary
Antigen: rec-8
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope: IDNNSELNAIYGCVEPYLREKEITMHSTFVEGNGSNEHNKERRNDAVIADFSQLLFPEIPEITLGEKFPIDVDSRKRS AILQEEQEEALQLPKEASEIVQ
Host: Rabbit
Isotype: IgG
Reactivity: C. elegans