To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:Olfactory Receptor, Family 1, Subfamily I Member 1
- Antigen Symbol:OR1I1
- Clonality:Monoclonal
- Clone:1G6
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Environmentally Preferable:
- Cross Adsorption:No
- Format:Liquid
- Gene ID:126370
- Antigen Synonyms:OR1I1Q|family 1|olfactory receptor 1I1|subfamily I|Olfactory receptor 19-20|member 1|olfactory receptor|OR19-20OR1I1P
- Amino Acid Number:293 - 355
- Storage Buffer:PBS (pH 7.4)
- Sequence:RNKDMKAALGKLIGKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYPGGVQSLAGNRDME
- Storage Temperature:Aliquot and store at −20 °C or −80 °C. Avoid freeze-thaw cycles.
- Immunogen:OR1I1 (NP_001004713.1, 293 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Purification:IgG purified
- Cat. No.:103346-652
- Supplier no.:H00126370-M04
Specifications
About this item
The OR1I1 Antibody (1G6) from Novus Biologicals is a mouse monoclonal antibody to OR1I1. This antibody reacts with human. The OR1I1 Antibody (1G6) has been validated for the following applications: Western Blot, ELISA.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: OR1I1
Clonality: Monoclonal
Clone: 1G6
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human