To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:Nuclear receptor related 1 protein
- Antigen Symbol:NURR1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Environmentally Preferable:
- Gene ID:4929
- Antigen Synonyms:transcriptionally inducible nuclear receptor related 1|T-cell nuclear receptor NOT|Transcriptionally-inducible nuclear receptor|nuclear receptor subfamily 4|member 2|human homolog of|Orphan nuclear receptor NURR1|group A|orphan nuclear receptor NR4A2
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:NR4A2 (NP_006177.1, 1 a.a. - 598 a.a.) full-length human protein. MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
- Purification:Protein G purified
- Cat. No.:103332-006
- Supplier no.:H00004929-D01P
Specifications
About this item
The Nurr1 / NGFI-B beta / NR4A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nurr1 / NGFI-B beta / NR4A2. This antibody reacts with human. The Nurr1 / NGFI-B beta / NR4A2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry / Immunofluorescence.
Type: Primary
Antigen: NURR1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human