To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:HPCL
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:26061
- Antigen Synonyms:1600020H07Rik|HPCL|phytanoyl-CoA hydroxylase 2|EC 4.1|Phytanoyl-CoA 2-hydroxylase 2|2-hydroxyacyl-CoA lyase 1|2,2-HPCL|PHYH2FLJ55041|2-hydroxyphytanoyl-CoA lyase2-hydroxyphytanol-CoA lyase
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:CVEGDSAFGFSGMEVETICRYNLPIILLVVNNNGIYQGFDTDTWKEMLKFQDATAVVPPMCLLPNSHYEQVMTAFGGKGYFVQTPEELQ
- Purification:Immunogen affinity purified
- Cat. No.:103276-582
- Supplier no.:NBP1-89384
Specifications
About this item
The HPCL Antibody from Novus Biologicals is a rabbit polyclonal antibody to HPCL. This antibody reacts with human, mouse, rat. The HPCL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: HPCL
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat