Order Entry
United States
ContactUsLinkComponent
Anti-GFR alpha-1/GDNF R alpha-1 Mouse Monoclonal Antibody [clone: 1G4]
Anti-GFR alpha-1/GDNF R alpha-1 Mouse Monoclonal Antibody [clone: 1G4]
Catalog # 103327-154
Supplier:  Avantor
Anti-GFR alpha-1/GDNF R alpha-1 Mouse Monoclonal Antibody [clone: 1G4]
Catalog # 103327-154
Supplier:  Avantor
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Name:
    GFR alpha-1/GDNF R alpha-1
  • Clonality:
    Monoclonal
  • Clone:
    1G4
  • Conjugation:
    Unconjugated
  • ELISA:
    Yes
  • Host:
    Mouse
  • ImmunoFluorescence:
    Yes
  • Isotype:
    IgG2a kappa
  • Reactivity:
    Human
  • Western Blot:
    Yes
  • Size:
    100 μg
  • Environmentally Preferable:
  • Gene ID:
    2674
  • Antigen Synonyms:
    GDNF family receptor alpha 1|TRNR1FLJ31546|Glial cell line-derived neurotrophic factor receptor alpha|GFR-alpha-1|DKFZp686J0156|GDNFRMGC23045|DKFZp313E1012|RET ligand 1|RET1L|PI-linked cell-surface accessory protein|GDNFRAGFR-ALPHA-1|GDNFR-alpha-1|GDNF receptor alpha-1|TGF-beta-related neurotrophic factor receptor 1|GDNF family receptor alpha-1|TGF-beta related neurotrophic factor receptor 1|RETL1FLJ10561|GPI-linked anchor protein
  • Storage Buffer:
    PBS (pH 7.4)
  • Storage Temperature:
    Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
  • Immunogen:
    GFRA1 (NP_005255, 32 a.a. - 119 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS
  • Purification:
    IgG purified
  • Cat. No.:
    103327-154
  • Supplier no.:
    H00002674-M01

Specifications

About this item

The GFR alpha-1 / GDNF R alpha-1 Antibody (1G4) from Novus Biologicals is a mouse monoclonal antibody to GFR alpha-1 / GDNF R alpha-1. This antibody reacts with human. The GFR alpha-1 / GDNF R alpha-1 Antibody (1G4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence.

Type: Primary
Antigen: GFR alpha-1/GDNF R alpha-1
Clonality: Monoclonal
Clone: 1G4
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human