To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:GFR alpha-1/GDNF R alpha-1
- Clonality:Monoclonal
- Clone:1G4
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoFluorescence:Yes
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Environmentally Preferable:
- Gene ID:2674
- Antigen Synonyms:GDNF family receptor alpha 1|TRNR1FLJ31546|Glial cell line-derived neurotrophic factor receptor alpha|GFR-alpha-1|DKFZp686J0156|GDNFRMGC23045|DKFZp313E1012|RET ligand 1|RET1L|PI-linked cell-surface accessory protein|GDNFRAGFR-ALPHA-1|GDNFR-alpha-1|GDNF receptor alpha-1|TGF-beta-related neurotrophic factor receptor 1|GDNF family receptor alpha-1|TGF-beta related neurotrophic factor receptor 1|RETL1FLJ10561|GPI-linked anchor protein
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:GFRA1 (NP_005255, 32 a.a. - 119 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS
- Purification:IgG purified
- Cat. No.:103327-154
- Supplier no.:H00002674-M01
Specifications
About this item
The GFR alpha-1 / GDNF R alpha-1 Antibody (1G4) from Novus Biologicals is a mouse monoclonal antibody to GFR alpha-1 / GDNF R alpha-1. This antibody reacts with human. The GFR alpha-1 / GDNF R alpha-1 Antibody (1G4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence.
Type: Primary
Antigen: GFR alpha-1/GDNF R alpha-1
Clonality: Monoclonal
Clone: 1G4
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human