Order Entry
United States
ContactUsLinkComponent
Anti-GABA-A R gamma 1 Rabbit Polyclonal Antibody
Anti-GABA-A R gamma 1 Rabbit Polyclonal Antibody
Catalog # 103278-172
Supplier:  Novus Biologicals
Anti-GABA-A R gamma 1 Rabbit Polyclonal Antibody
Catalog # 103278-172
Supplier:  Novus Biologicals
Supplier Number:  NBP1-91003
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Name:
    GABA-A R gamma 1
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • ImmunoChemistry:
    Yes
  • Isotype:
    IgG
  • Reactivity:
    Turkey,
    Human
  • Size:
    100 μl
  • Environmentally Preferable:
  • Gene ID:
    2565
  • Antigen Synonyms:
    gamma-aminobutyric acid receptor subunit gamma-1|DKFZp686H2042|gamma-1 polypeptide|gamma-aminobutyric acid (GABA) A receptor|MGC33838|gamma 1|GABA(A) receptor subunit gamma-1
  • Storage Buffer:
    PBS (pH 7.2) and 40% Glycerol
  • Storage Temperature:
    Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
  • Immunogen:
    This antibody was developed against Recombinant Protein corresponding to amino acids:RGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQIL
  • Purification:
    Immunogen affinity purified
  • Cat. No.:
    103278-172
  • Supplier no.:
    NBP1-91003

Specifications

About this item

The GABA-A R gamma 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GABA-A R gamma 1. This antibody reacts with human, turkey. The GABA-A R gamma 1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.

Type: Primary
Antigen: GABA-A R gamma 1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Turkey