To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:DNA polymerase sigma
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:11044
- Antigen Synonyms:PAP associated domain containing 7|DNA polymerase sigma|Topoisomerase-related function protein 4-1|POLSTUTASE5|DNA polymerase kappa|EC 2.7.7.7|Terminal uridylyltransferase 5|LAK-1TUTase 5|TRF4-1LAK1|polymerase (DNA directed) sigma|polymerase (DNA-directed) sigma|TRF4PAP-associated domain-containing protein 7|POLKTRF41
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids: PNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGH HQYNRTGWRRKKHTHTRDSLPVSLSR
- Purification:Immunogen affinity purified
- Cat. No.:103283-808
- Supplier no.:NBP2-13728
Specifications
About this item
The DNA polymerase sigma Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNA polymerase sigma. This antibody reacts with human, mouse, rat. The DNA polymerase sigma Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: DNA polymerase sigma
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat