To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:FGF-8
- Clonality:Monoclonal
- Clone:2A12
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2b kappa
- Reactivity:Human
- Size:100 μg
- Environmentally Preferable:
- Gene ID:2253
- Antigen Synonyms:FGF-8|fibroblast growth factor 8 (androgen-induced)|MGC149376|Androgen-induced growth factor|AIGFKAL6|fibroblast growth factor 8|Heparin-binding growth factor 8|HBGF-8
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:FGF8 (NP_149354 65 a.a. - 133 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
- Purification:IgG purified
- Cat. No.:103326-350
- Supplier no.:H00002253-M03
Specifications
About this item
The FGF-8 Antibody (2A12) from Novus Biologicals is a mouse monoclonal antibody to FGF-8. This antibody reacts with human. The FGF-8 Antibody (2A12) has been validated for the following applications: ELISA.
Type: Primary
Antigen: FGF-8
Clonality: Monoclonal
Clone: 2A12
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human