Order Entry
United States
ContactUsLinkComponent
Anti-FGF-8 Mouse Monoclonal Antibody [clone: 2A12]
Anti-FGF-8 Mouse Monoclonal Antibody [clone: 2A12]
Catalog # 103326-350
Supplier:  Novus Biologicals
Anti-FGF-8 Mouse Monoclonal Antibody [clone: 2A12]
Catalog # 103326-350
Supplier:  Novus Biologicals
Supplier Number:  H00002253-M03
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Symbol:
    FGF-8
  • Clonality:
    Monoclonal
  • Clone:
    2A12
  • Conjugation:
    Unconjugated
  • ELISA:
    Yes
  • Host:
    Mouse
  • Isotype:
    IgG2b kappa
  • Reactivity:
    Human
  • Size:
    100 μg
  • Environmentally Preferable:
  • Gene ID:
    2253
  • Antigen Synonyms:
    FGF-8|fibroblast growth factor 8 (androgen-induced)|MGC149376|Androgen-induced growth factor|AIGFKAL6|fibroblast growth factor 8|Heparin-binding growth factor 8|HBGF-8
  • Storage Buffer:
    PBS (pH 7.4)
  • Storage Temperature:
    Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
  • Immunogen:
    FGF8 (NP_149354 65 a.a. - 133 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
  • Purification:
    IgG purified
  • Cat. No.:
    103326-350
  • Supplier no.:
    H00002253-M03

Specifications

About this item

The FGF-8 Antibody (2A12) from Novus Biologicals is a mouse monoclonal antibody to FGF-8. This antibody reacts with human. The FGF-8 Antibody (2A12) has been validated for the following applications: ELISA.

Type: Primary
Antigen: FGF-8
Clonality: Monoclonal
Clone: 2A12
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human