Order Entry
United States
ContactUsLinkComponent
Anti-EIF3A Mouse Monoclonal Antibody [clone: 2G4]
Anti-EIF3A Mouse Monoclonal Antibody [clone: 2G4]
Catalog # 103335-386
Supplier:  Novus Biologicals
Anti-EIF3A Mouse Monoclonal Antibody [clone: 2G4]
Catalog # 103335-386
Supplier:  Novus Biologicals
Supplier Number:  H00008661-M02
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Symbol:
    EIF3A
  • Clonality:
    Monoclonal
  • Clone:
    2G4
  • Conjugation:
    Unconjugated
  • ELISA:
    Yes
  • Host:
    Mouse
  • Isotype:
    IgG2a kappa
  • Reactivity:
    Human
  • Western Blot:
    Yes
  • Size:
    100 μg
  • Environmentally Preferable:
  • Gene ID:
    8661
  • Antigen Synonyms:
    eIF3 p167|centrosomin homolog|eIF3-p170|eIF3a|p180|KIAA0139P167|subunit 10|subunit 10 theta|eukaryotic translation initiation factor 3|EIF3|eIF3-theta|p180 subunit|170kD)|170kD|eIF-3-theta|150/170kDa|TIF32|p185|EIF3S10EIF3|cytoplasmic protein p167|eIF3 p185|subunit A|eukaryotic translation initiation factor 3 subunit A|eIF3 p180|Eukaryotic translation initiation factor 3 subunit 10|subunit 10 (theta|150/170kD)
  • Storage Buffer:
    PBS (pH 7.4)
  • Storage Temperature:
    Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
  • Immunogen:
    EIF3A (NP_003741, 1 a.a. - 75 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK
  • Purification:
    IgG purified
  • Cat. No.:
    103335-386
  • Supplier no.:
    H00008661-M02

Specifications

About this item

The EIF3A Antibody (2G4) from Novus Biologicals is a mouse monoclonal antibody to EIF3A. This antibody reacts with human. The EIF3A Antibody (2G4) has been validated for the following applications: Western Blot, ELISA.

Type: Primary
Antigen: EIF3A
Clonality: Monoclonal
Clone: 2G4
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human