To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:EIF3A
- Clonality:Monoclonal
- Clone:2G4
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Environmentally Preferable:
- Gene ID:8661
- Antigen Synonyms:eIF3 p167|centrosomin homolog|eIF3-p170|eIF3a|p180|KIAA0139P167|subunit 10|subunit 10 theta|eukaryotic translation initiation factor 3|EIF3|eIF3-theta|p180 subunit|170kD)|170kD|eIF-3-theta|150/170kDa|TIF32|p185|EIF3S10EIF3|cytoplasmic protein p167|eIF3 p185|subunit A|eukaryotic translation initiation factor 3 subunit A|eIF3 p180|Eukaryotic translation initiation factor 3 subunit 10|subunit 10 (theta|150/170kD)
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:EIF3A (NP_003741, 1 a.a. - 75 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK
- Purification:IgG purified
- Cat. No.:103335-386
- Supplier no.:H00008661-M02
Specifications
About this item
The EIF3A Antibody (2G4) from Novus Biologicals is a mouse monoclonal antibody to EIF3A. This antibody reacts with human. The EIF3A Antibody (2G4) has been validated for the following applications: Western Blot, ELISA.
Type: Primary
Antigen: EIF3A
Clonality: Monoclonal
Clone: 2G4
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human