To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:beta-Defensin 4/2
- Clonality:Monoclonal
- Clone:4C4
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Environmentally Preferable:
- Gene ID:1673
- Antigen Synonyms:beta 4|DEFB4beta-defensin 4A|beta 2Skin-antimicrobial peptide 1|defensin|DEFB-2|SAP1BD-2|Defensin|beta 4A|Beta-defensin 2|HBD-2|DEFB2DEFB102
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:DEFB4 (NP_004933, 24 a.a. - 64 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
- Purification:IgG purified
- Cat. No.:103325-034
- Supplier no.:H00001673-M01
Specifications
About this item
The beta-Defensin 4 / 2 Antibody (4C4) from Novus Biologicals is a mouse monoclonal antibody to beta-Defensin 4 / 2. This antibody reacts with human. The beta-Defensin 4 / 2 Antibody (4C4) has been validated for the following applications: Western Blot, ELISA.
Type: Primary
Antigen: beta-Defensin 4/2
Clonality: Monoclonal
Clone: 4C4
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human