To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Symbol:CAPZB
- Clonality:Monoclonal
- Clone:4H8
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Environmentally Preferable:
- Gene ID:832
- Antigen Synonyms:CAPPB|F-actin capping protein beta subunit|Cap Z|capping protein (actin filament) muscle Z-line|CAPB|MGC104401|CapZ beta|beta|MGC129749|F-actin-capping protein subunit beta|MGC129750|CAPZ
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:CAPZB (NP_004921 192 a.a. - 272 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
- Purification:IgG purified
- Cat. No.:103323-156
- Supplier no.:H00000832-M03
The CAPZB Antibody (4H8) from Novus Biologicals is a mouse monoclonal antibody to CAPZB. This antibody reacts with human. The CAPZB Antibody (4H8) has been validated for the following applications: Western Blot, ELISA.
Type: Primary
Antigen: CAPZB
Clonality: Monoclonal
Clone: 4H8
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human