To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Symbol:ABCC9
- Clonality:Monoclonal
- Clone:S319A-14
- Conjugation:Unconjugated
- Host:Mouse
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG2a
- Reactivity:Mouse
- Western Blot:Yes
- Size:100 μg
- Environmentally Preferable:
- Gene ID:10060
- Antigen Synonyms:Sulfonylurea receptor 2|FLJ36852|sub-family C (CFTR/MRP)|EC 3.6.3.44|SUR2ATP-binding cassette sub-family C member 9|ATP-binding cassette|ABC37|CMD1OATP-binding cassette transporter sub-family C member 9|sulfonylurea receptor 2A|member 9
- Storage Buffer:PBS (pH 7.4) and 50% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Concentration:1 mg/ml
- Immunogen:Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
- Purification:Protein G purified
- Cat. No.:103406-478
The ABCC9 Antibody (S319A-14) from Novus Biologicals is a mouse monoclonal antibody to ABCC9. This antibody reacts with mouse. The ABCC9 Antibody (S319A-14) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence.
Type: Primary
Antigen: ABCC9
Clonality: Monoclonal
Clone: S319A-14
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a
Reactivity: Mouse