Order Entry
United States
ContactUsLinkComponent
3 x Hemagglutinin (HA) Tag
3 x Hemagglutinin (HA) Tag
Catalog # 103007-714
Supplier:  Anaspec Inc
CAS Number:  
3 x Hemagglutinin (HA) Tag
Catalog # 103007-714
Supplier:  Anaspec Inc
Supplier Number:  AS-63764
CAS Number:  
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Conjugation:
    Unconjugated
  • Source:
  • Species:
  • Size:
    1 mg
  • Environmentally Preferable:
  • Storage Conditions:
    –20 °C
  • Protein Synonyms:
    HA tag Peptide
  • Protein/Peptide Name:
    3 x Hemagglutinin (HA) Tag
  • Purity:
    95%
  • Molecular Weight:
    4372.7 Da
  • Sequence:
    MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
  • Cat. No.:
    103007-714
  • Supplier no.:
    AS-63764

Specifications

About this item

This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.
Sequence:MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
MW:4372.7 Da
% peak area by HPLC:95
Storage condition:-20° C