To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Name:Nicotinamide Riboside Kinase
- Antigen Symbol:NRK
- Clonality:Monoclonal
- Clone:4C7
- Conjugation:Unconjugated
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:
- Western Blot:Yes
- Size:100 µg
- Environmentally Preferable:
- Cross Adsorption:No
- Format:Liquid
- Gene ID:203447
- Amino Acid Number:1483 to 1582
- Storage Buffer:1x PBS, pH 7.4
- Sequence:VEANEQLFKKILEMWKDIPSSIAFECTQRTTGWGQKAIEVRSLQSRVLESELKRRSIKKLRFLCTRGDKLFFTSTLRNHHSRVYFMTLGKLEELQSNYDV
- Storage Temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:NRK (NP_940867, 1483 a.a. ~ 1582 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Cat. No.:10594-810
- Supplier no.:H00203447-M01
Mouse monoclonal antibody raised against a partial recombinant NRK.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: NRK
Clonality: Monoclonal
Clone: 4C7
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: 0