Anti-CABIN1 Mouse Monoclonal Antibody [clone: 2F5]
10623-910
: Abnova
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Name:calcineurin binding protein 1
- Antigen Symbol:CABIN1
- Clonality:Monoclonal
- Clone:2F5
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:200 µL
- Environmentally Preferable:
- Cross Adsorption:No
- Format:Liquid
- Form:Ascites fluid
- Gene ID:23523
- Antigen Synonyms:CAIN|PPP3IN|KB-318B8.7
- Amino Acid Number:1 to 110
- Sequence:MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYHELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAM
- Storage Temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:CABIN1 (NP_036427, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Cat. No.:10623-910
- Supplier no.:H00023523-M02A
Mouse monoclonal antibody raised against a partial recombinant CABIN1.
Type: Primary
Antigen: CABIN1
Clonality: Monoclonal
Clone: 2F5
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1
Reactivity: Human