To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:A kinase anchor protein 9
- Antigen Symbol:AKAP9
- Clonality:Monoclonal
- Clone:7E12
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoFluorescence:Yes
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 µg
- Environmentally Preferable:
- Cross Adsorption:No
- Format:Liquid
- Gene ID:10142
- Antigen Synonyms:A-kinase anchor protein|A-kinase anchoring protein 450|AKAP450|CG-NAP|AKAP350|YOTIAO|protein kinase A anchoring protein 9|kinase N-associated protein|MU-RMS-40.16A|AKAP9|A kinase (PRKA) anchor protein (yotiao) 9|KIAA0803|PRKA9|350kDa|AKAP120-like protein|HYPERION|centrosome- and golgi-localized protein|A-kinase anchor protein 9|AKAP9-BRAF fusion protein
- Amino Acid Number:3812 to 3911
- Storage Buffer:1x PBS, pH 7.4
- Sequence:EKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGSTTQFHAGMRR
- Storage Temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:AKAP9 (NP_671700, 3812 a.a. ~ 3911 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Cat. No.:10576-538
- Supplier no.:H00010142-M07
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant AKAP9.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: AKAP9
Clonality: Monoclonal
Clone: 7E12
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human