To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Name:Left-right determination Factor 1
- Antigen Symbol:LEFTY1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Mouse
- Isotype:
- Reactivity:Human
- Western Blot:Yes
- Size:50 µg
- Environmentally Preferable:
- Cross Adsorption:No
- Format:Liquid
- Gene ID:10637
- Antigen Synonyms:lefty-1|Tgfb4|Stra3|AI450052|Ebaf|LEFTYB |lefty|LEFTB
- Amino Acid Number:1 to 366
- Storage Buffer:1x PBS, pH 7.4
- Sequence:MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
- Storage Temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:LEFTY1 (NP_066277.1, 1 a.a. ~ 366 a.a) full-length human protein.
- Cat. No.:10562-922
- Supplier no.:H00010637-B01P
Mouse polyclonal antibody raised against a full-length human LEFTY1 protein.
Recommended Dilutions: Western Blot: 1 ?g/ml
Type: Primary
Antigen: LEFTY1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human