To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:Calbindin 1 28kDa
- Antigen Symbol:CALB1
- Clonality:Monoclonal
- Clone:1F6
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 µg
- Environmentally Preferable:
- Cross Adsorption:No
- Format:Liquid
- Gene ID:793
- Antigen Synonyms:CALB|Calb|Calb-1|CB|Calbindin 1 28kDa|Brain-2
- Amino Acid Number:1 to 261
- Storage Buffer:1x PBS, pH 7.4
- Sequence:MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN
- Storage Temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:CALB1 (NP_004920.1, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Cat. No.:10578-498
- Supplier no.:H00000793-M01
Specifications
About this item
Mouse monoclonal antibody raised against a full-length recombinant CALB1.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: CALB1
Clonality: Monoclonal
Clone: 1F6
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1
Reactivity: Human