To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Name:Talin 1
- Antigen Symbol:TLN1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:
- Reactivity:Human
- Western Blot:Yes
- Size:100 µg
- Environmentally Preferable:
- Cross Adsorption:No
- Format:Liquid
- Gene ID:21894
- Antigen Synonyms:TLN|TLN1|ILWEQ|talin 1|KIAA1027
- Storage Buffer:PBS (50% glycerol, 0.02% sodium azide)
- Sequence:PASPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSL
- Storage Temperature:Store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant GST fusion protein corresponding to 156 mouse Tln1.
- Cat. No.:10741-378
- Supplier no.:PAB15690
Rabbit polyclonal antibody raised against partial recombinant Tln1.
Recommended Dilutions: Western Blot: 1:1000
Type: Primary
Antigen: TLN1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human