To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:CCCTC-binding factor (Zinc Finger Protein)-like
- Antigen Symbol:CTCFL
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 µL
- Environmentally Preferable:
- Cross Adsorption:No
- Format:Liquid
- Gene ID:140690
- Antigen Synonyms:BORIS|HMGB1L1|CTCF-T|dJ579F20.2|CT27
- Storage Buffer:PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
- Sequence:DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS
- Storage Temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human CTCFL.
- Purification:Antigen affinity purification
- Cat. No.:10709-322
- Supplier no.:PAB20061
Specifications
About this item
Rabbit polyclonal antibody raised against recombinant CTCFL.
Recommended Dilutions: Immunohistochemistry: 1:50-1:200; Immunofluorescence: 1-4 ?g/ml
Type: Primary
Antigen: CTCFL
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: