Anti-Apolipoprotein CII / ApoC-II Rabbit Polyclonal Antibody
ANTIA8964-100
New Product
- Antibody type:Primary
- Antigen symbol:Apolipoprotein CII / ApoC-II
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# P02655
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:11 kDa
- Sequence:MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human APOC2 (NP_000474.2)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to Apolipoprotein CII / ApoC-II for WB with samples derived from Human and Rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:100 to 1:50
Type: Primary
Antigen: Apolipoprotein CII / ApoC-II
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Rat