Anti-Isoleucyl tRNA synthetase Rabbit Polyclonal Antibody
ANTIA8547-100
New Product
- Antibody type:Primary
- Antigen name:FLJ20736
- Antigen symbol:Isoleucyl tRNA synthetase
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# P41252
- Antigen synonyms:IRS|Isoleucine tRNA ligase|Isoleucine tRNA ligase 1 cytoplasmic|IARS1|Isoleucine tRNA synthetase|IleRS|IARS|ILRS|Isoleucyl tRNA synthetase
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,02% sodium azide
- Molecular weight:144 kDa
- Sequence:SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human IARS (NP_002152.2)
- Tested applications:IHC
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to Isoleucyl tRNA synthetase for WB and IHC with samples derived from human, mouse and rat.
- Validated applications: WB, IHC
- Recommended dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:10
Type: Primary
Antigen: Isoleucyl tRNA synthetase
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat