Anti-CELF-6 Rabbit Polyclonal Antibody
Catalog # ANTIA306570-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:6330569O16Rik
- Antigen symbol:CELF-6
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# Q96J87
- Antigen synonyms:Bruno-like protein 6|bruno like 6, RNA binding protein|CELF6_HUMAN|CELF-6|CUG-BP- and ETR-3-like factor 6|Celf6|BRUNOL6|Bruno like protein 6|Bruno like 6, RNA binding protein (Drosophila)
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% Thiomersal
- Molecular weight:51 kDa
- Sequence:LGAFHPAPLPLGACGAYTTAILQHQAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGPGTLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLSPYPAQSPGVADPLQQAYAGMHHYAAAYPSAYAPVSTAFPQ
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 230-380 of human CELF6 (NP_443072.3).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to CELF-6 for WB with samples derived from Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: CELF-6
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse;Rat