Anti-Caspase-10 / CASP-10 Rabbit Polyclonal Antibody
ANTIA8377-100
New Product
- Antibody type:Primary
- Antigen symbol:Caspase-10 / CASP-10
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# Q92851
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,02% Sodium azide
- Molecular weight:72 kDa
- Sequence:VKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILTAVNDDVSRRVDKQGTKKQMPQPAFTLRKKLVFPVPLDALS
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 220-521 of human Caspase-10 (NP_116759.2)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to Caspase-10 / CASP-10 for WB with samples derived from human and mouse.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:200
Type: Primary
Antigen: Caspase-10 / CASP-10
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse