Anti-PH3 Rabbit Polyclonal Antibody
Catalog # ANTIA11978-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:Early development regulator 3
- Antigen symbol:PH3
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# Q8NDX5
- Antigen synonyms:Homolog of polyhomeotic 3|PHC 3|PHC3_HUMAN|hPH3|EDR3|Early development regulatory protein 3|HPH 3|PHC3|Polyhomeotic homolog 3
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:106 kDa
- Sequence:LSSSQLQSLAAVQASLSSGRPSTSPTGSVTQQSSMSQTSINLSTSPTPAQLISRSQASSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQMLIFTPATTVAAVQSDIPVVSSSSSSSCQSAATQVQNLTLRSQKLGVLSSSQNGPPKSTSQTQSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRSTAVTRTSSI
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 100 - 300 of human PHC3 (NP_079223.3)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to PH3 for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: PH3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat