Anti-GABRR2 Rabbit Polyclonal Antibody
Catalog # ANTIA11244-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:GABA receptor Rho 2 subunit
- Antigen symbol:GABRR2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# P28476
- Antigen synonyms:GABA(A) receptor|Gamma aminobutyric acid receptor rho 2 subunit [Precursor]|GABA(C) receptor|GABRR 2|Gamma-aminobutyric acid (GABA) A receptor, rho 2|GABA(A) receptor subunit rho-2|Gamma-aminobutyric acid receptor subunit rho-2|GABRR2|Rho 2 GABA receptor
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:65 kDa
- Sequence:TVQERKERKLREKFPCMCGMLHSKTMMLDGSYSESEANSLAGYPRSHILTEEERQDKIVVHLGLSGEANAARKKGLLKGQTGFRIFQNTHAIDKYSRLIFP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 350 - 450 of human GABRR2 (NP_002034.3)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to GABRR2 for WB with samples derived from human and mouse.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: GABRR2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse