Anti-IL37 Rabbit Polyclonal Antibody
ANTIA10336-100
New Product
- Antibody type:Primary
- Antigen name:FIL1
- Antigen symbol:IL37
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# Q9NZH6
- Antigen synonyms:Z|(ZETA)|IL 1H4|IL 1 zeta|IL 1RP1|IL 1F7b (IL 1H4, IL 1H, IL 1RP1)|IL 1X|zeta|IL 1F7
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:24 kDa
- Sequence:MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 218 of human IL37 (NP_055254.2)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to IL37 for WB with samples derived from human.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: IL37
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human