Anti-RPP20 Rabbit Polyclonal Antibody
Catalog # ANTIA10329-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:RNaseP protein p20
- Antigen symbol:RPP20
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# O75817
- Antigen synonyms:0610037N12Rik|Ribonuclease P, 20-KD subunit|Ribonucleases P/MRP protein subunit POP7 homolog|POP7 (processing of precursor, S. cerevisiae) homolog|POP7_HUMAN|hPOP7|Ribonuclease P protein subunit p20|processing of precursor 7 ribonuclease P subunit (S. cerevisiae)|processing of precursor 7, S. cerevisiae, homolog of
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:14 kDa
- Sequence:MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 140 of human POP7 (NP_005828.2)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to RPP20 for WB with samples derived from human.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: RPP20
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human