Anti-Puma gamma/GPR109A Rabbit Monoclonal Antibody [clone: ARC54160]
ANTIA305514-100
New Product
- Antibody type:Primary
- Antigen symbol:Puma gamma / GPR109A
- Clonality:Monoclonal
- Clone:ARC54160
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# Q8TDS4
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,05% proclin 300
- Molecular weight:42 kDa
- Sequence:CRLMLFMLAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNRTAAIISCLLWGITIGLTVHLLKKKMPIQNGGANLCSSFSICHTFQWHEAMFLLEFFLP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100 - 200 of human GPR109A/HM74A/HCAR2 (NP_808219.1).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC54160] antibody to Puma gamma/GPR109A for WB with samples derived from rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:1000 to 1:5000
Type: Primary
Antigen: Puma gamma/GPR109A
Clonality: Monoclonal
Clone: ARC54160
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Rat