Anti-RIC8A Mouse Monoclonal Antibody [clone: 1H6]
Catalog # ABNOH00060626-M01
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Synembryn-A
- Antigen symbol:RIC8A
- Clonality:Monoclonal
- Clone:1H6
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Gene ID:60626
- Antigen synonyms:synembryn|RIC8|RIC8 protein|resistance to inhibitors of cholinesterase 8 homolog A|MGC148073|MGC148074|MGC131931|RIC8A|MGC104517|resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)
- Amino acid number:462 to 534
- Storage buffer:1x PBS, pH 7,4
- Sequence:VTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDS
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:RIC8A (NP_068751.4, 462 a.a. ~ 534 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant RIC8A.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: RIC8A
Clonality: Monoclonal
Clone: 1H6
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human