Anti-NRXN1 Mouse Monoclonal Antibody [clone: 4F7]
Catalog # ABNOH00009378-M02
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Neurexin 1
- Antigen symbol:NRXN1
- Clonality:Monoclonal
- Clone:4F7
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2b kappa
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Gene ID:9378
- Antigen synonyms:Hs.22998|PTHSL2|Nrxn1b|SCZD17
- Amino acid number:31 to 130
- Storage buffer:1x PBS, pH 7,4
- Sequence:LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFI
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:NRXN1 (NP_004792, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant NRXN1.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: NRXN1
Clonality: Monoclonal
Clone: 4F7
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b kappa
Reactivity: Human