Anti-CHAC1 Rabbit Polyclonal Antibody
ORIGTA329470
: OriGene
- Antibody type:Primary
- Antigen name:Glutathione-specific gamma-glutamylcyclotransferase 1
- Antigen symbol:CHAC1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Form:Liquid
- Storage buffer:Lyophilized powder. Add 50 ul of distilled water. Final anti-CHAC1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
- Molecular weight:24 kDa
- Sequence:TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
- Storage temperature:–20 °C
- Shipping temperature:–20 °C
- Immunogen:The immunogen for anti-CHAC1 antibody: synthetic peptide directed towards the C terminal of human CHAC1. Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
- Size:50 μg
- Pk:50 µG
Type: Primary
Antigen: CHAC1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human